Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse 3-keto-steroid reductase(Hsd17b7)

Recombinant Mouse 3-keto-steroid reductase(Hsd17b7)

SKU:CSB-CF010776MO-GB

Regular price ¥297,000 JPY
Regular price Sale price ¥297,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88736

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS

Protein Names:Recommended name: 3-keto-steroid reductase EC= 1.1.1.270 Alternative name(s): 17-beta-hydroxysteroid dehydrogenase 7 Short name= 17-beta-HSD 7 Estradiol 17-beta-dehydrogenase 7 EC= 1.1.1.62

Gene Names:Name:Hsd17b7

Expression Region:1-334

Sequence Info:full length protein

View full details