Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meyerozyma guilliermondii Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

Recombinant Meyerozyma guilliermondii Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

SKU:CSB-CF399219MTM

Regular price ¥257,100 JPY
Regular price Sale price ¥257,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)

Uniprot NO.:A5DLM7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFPADSNLILIMPGHARYRDPKTFEMSPALVRVRAPYFWRNTLAFIVVGSIPLGVYAYT WSFLNKDEFSDIPIPPVSDEELAKLKKEYANKK

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial

Gene Names:Name:COA3 ORF Names:PGUG_04178

Expression Region:1-93

Sequence Info:full length protein

View full details