Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methylobacterium nodulans UPF0060 membrane protein Mnod_6500 (Mnod_6500)

Recombinant Methylobacterium nodulans UPF0060 membrane protein Mnod_6500 (Mnod_6500)

SKU:CSB-CF491419MTB

Regular price ¥258,900 JPY
Regular price Sale price ¥258,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methylobacterium nodulans (strain ORS2060 / LMG 21967)

Uniprot NO.:B8IDA3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTLLAYVGAALAEIAGCFAVWAWLRLGRSPLWLGPGLASLALFAVLLTRVESGAAGRAY AAYGGVYIAASLVWLWGVEGQRPDRWDLGGAALCLAGTAVILLGPRG

Protein Names:Recommended name: UPF0060 membrane protein Mnod_6500

Gene Names:Ordered Locus Names:Mnod_6500

Expression Region:1-107

Sequence Info:full length protein

View full details