Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methylobacterium extorquens Methylamine utilization protein mauE(mauE)

Recombinant Methylobacterium extorquens Methylamine utilization protein mauE(mauE)

SKU:CSB-CF674279MSZ

Regular price ¥275,000 JPY
Regular price Sale price ¥275,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1)

Uniprot NO.:Q49125

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIMALLAEPVVTTFVRAFLILLLASAAIPKLRHGEEFFGVVRNFRLMPEWLARPFALVLP WLELGIAVGLVLPVTAPLAAGLAGGLMVLFGIAIAINVARGRTAIDCGCFRNGMKQKLSW LLVGRNAGLALAAFGLAWLLPVAPAAGPFDLAIGFAAAGLTMLLIYGASLLSGLQSGARS SQLSKG

Protein Names:Recommended name: Methylamine utilization protein mauE

Gene Names:Name:mauE Ordered Locus Names:MexAM1_META1p2771

Expression Region:1-186

Sequence Info:full length protein

View full details