Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanothermobacter marburgensis Tetrahydromethanopterin S-methyltransferase subunit D(mtrD)

Recombinant Methanothermobacter marburgensis Tetrahydromethanopterin S-methyltransferase subunit D(mtrD)

SKU:CSB-CF305270MSQ

Regular price ¥273,900 JPY
Regular price Sale price ¥273,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Uniprot NO.:P80183

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDPLLLIGAITAGGVLIGGGVHFVPVGGAPAAMATATGVGTGTAMLAAGAGLTGLITAAA MTGQSPLMIMAAGAVGSMLMIGITMLVGNLIYVFGVGTVPVSAKVSVDPITGMEQEKYVT PGTEGHGLPTVCFVSGIIGGALGGIGGGLIYWALNEALKTLSYGAMGAAGVAAIFAVGIF FINAVIASYNIGGTIEGFHDPKFKRIGRGIVACLIASIVAGALSTLLVYGGVF

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit D EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit D

Gene Names:Name:mtrD Ordered Locus Names:MTBMA_c15460

Expression Region:1-233

Sequence Info:full length protein

View full details