Gene Bio Systems
Recombinant Methanospirillum hungatei Protein CrcB homolog 1(crcB1)
Recombinant Methanospirillum hungatei Protein CrcB homolog 1(crcB1)
SKU:CSB-CF642006MAAQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanospirillum hungatei (strain JF-1 / DSM 864)
Uniprot NO.:Q2FLB8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCLNIFRTFKSYFGCNITFVPKESALVGIGGCIGSVARYQINEWIPSLLGTFIVNVLGCI AIGFLMYESIYFGAFSRNSRLFLGAGLIGSFTTFSAFATQTIEAGLFYGIIFIAANILCG LMGVFIGRQIILRGRRSWNI
Protein Names:Recommended name: Protein CrcB homolog 1
Gene Names:Name:crcB1 Ordered Locus Names:Mhun_1098
Expression Region:1-140
Sequence Info:full length protein
