Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosphaera stadtmanae UPF0290 protein Msp_0385(Msp_0385)

Recombinant Methanosphaera stadtmanae UPF0290 protein Msp_0385(Msp_0385)

SKU:CSB-CF649893MAAR

Regular price ¥274,000 JPY
Regular price Sale price ¥274,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanosphaera stadtmanae (strain DSM 3091)

Uniprot NO.:Q2NHB7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDILTLIFYSIYLMIPAYLANGSALVFGGGTPMDFGHYCWDNRRLIGNGVTWRGTVCGGL FGMVIGGILGLLATYGIGSYFFNITASQITFMSGFVPQGLLVGFLLGFGALIGDAIGSFL KRRLNFERGKPVPLLDQLDFVVVSLLFVSTVVSLSLEMIVIIILVSIFLHLGANMFAYMI NLKDVWY

Protein Names:Recommended name: UPF0290 protein Msp_0385

Gene Names:Ordered Locus Names:Msp_0385

Expression Region:1-187

Sequence Info:full length protein

View full details