Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina barkeri Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)

Recombinant Methanosarcina barkeri Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)

SKU:CSB-CF897359MSM

Regular price ¥218,600 JPY
Regular price Sale price ¥218,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosarcina barkeri (strain Fusaro / DSM 804)

Uniprot NO.:Q9Y8K6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDGKAPAAFVEPGEFNEVMKRLDKIDEKIEFVNSEVAQKIGKKVGRDIGILYGGFIGLLL FLIYTVVSSMFM

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit G EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G

Gene Names:Name:mtrG Ordered Locus Names:Mbar_A1256

Expression Region:1-72

Sequence Info:full length protein

View full details