Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanosarcina acetivorans UPF0060 membrane protein MA_3936(MA_3936)

Recombinant Methanosarcina acetivorans UPF0060 membrane protein MA_3936(MA_3936)

SKU:CSB-CF844774MFB

Regular price ¥269,100 JPY
Regular price Sale price ¥269,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Uniprot NO.:Q8TJ52

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIELGVSLCPFFLAALFEIRGGYLICLWLRNNMRAVFGPLGRLMLAVCGIIPTFQPSHFG RVYAAHGGIFIVFSLIWDLFVDKKIPDRYDHRGNNNVCGCFHYVLRLSLIGRYSVISFCN FQTPRQRISDFFLSRSIKHNFYLFFCNQTLGNYFV

Protein Names:Recommended name: UPF0060 membrane protein MA_3936

Gene Names:Ordered Locus Names:MA_3936

Expression Region:1-155

Sequence Info:full length protein

View full details