Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanoculleus marisnigri UPF0290 protein Memar_1002 (Memar_1002)

Recombinant Methanoculleus marisnigri UPF0290 protein Memar_1002 (Memar_1002)

SKU:CSB-CF387399MNU

Regular price ¥268,400 JPY
Regular price Sale price ¥268,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

Uniprot NO.:A3CU85

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIPAYVPNSAAALFGGGTPIDLGRTFSDGRRVFGDGKTYRGFFGGVVSGVLVGLIEIWAA TAFSLSALPQQTFLSVTLLATGALLGDLAKSFLKRRLGKDRGESWFLADQYDLVVGSFLL ILIFDPQWLFGTITLPIAVWIVVMTPLLHRVVNIIGYYIGVKEVPW

Protein Names:Recommended name: UPF0290 protein Memar_1002

Gene Names:Ordered Locus Names:Memar_1002

Expression Region:1-166

Sequence Info:full length protein

View full details