Gene Bio Systems
Recombinant Methanocorpusculum labreanum UPF0290 protein Mlab_0318 (Mlab_0318)
Recombinant Methanocorpusculum labreanum UPF0290 protein Mlab_0318 (Mlab_0318)
SKU:CSB-CF385989MNT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Uniprot NO.:A2SQ88
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIPAYIPNPAAALLGGGTPVDFGKCAKDGRRILGDGKTWRGLIGGIVVGIIFGLMQIFLY NYFNLEFLPKQTIITVCALATGALLGDMVKSYFKRRLGKDRGAKWPIADMYDMVVGSLVL MTLALLVTGNLNWFTENFDSVGFLIATIIAILILSPLLHRGTNIIGYLLGLKDVPW
Protein Names:Recommended name: UPF0290 protein Mlab_0318
Gene Names:Ordered Locus Names:Mlab_0318
Expression Region:1-176
Sequence Info:full length protein
