Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 1(cbiM1)

Recombinant Methanocorpusculum labreanum Putative cobalt transport protein CbiM 1(cbiM1)

SKU:CSB-CF383618MNT

Regular price ¥273,400 JPY
Regular price Sale price ¥273,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)

Uniprot NO.:A2SQF0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHFMDGFLPIGWCVFWAVLAAPFLIYGMWKITKMINNDRHVLPLMAVCGAFIFVVSLVDI PSPTGSCSHPTGTGLSASFFGPAVTSVLGLIILVFQALLLGHGGFTTLGATAFSMAVMGP LAAWLVFKGLRKTGRVPLGPAVFCAAVVANCVTYLITSLQIALAYPVEGSVLTAFLAAAA VFAVVQIPISIIEGIISGLVATYIARIKPEILQKLGVISGEEVKKVLSEQA

Protein Names:Recommended name: Putative cobalt transport protein CbiM 1 Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM 1 Short name= ECF transporter S component CbiM 1

Gene Names:Name:cbiM1 Ordered Locus Names:Mlab_0380

Expression Region:1-231

Sequence Info:full length protein

View full details