Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanococcus maripaludis UPF0290 protein MmarC6_0973 (MmarC6_0973)

Recombinant Methanococcus maripaludis UPF0290 protein MmarC6_0973 (MmarC6_0973)

SKU:CSB-CF428964MNQ

Regular price ¥272,100 JPY
Regular price Sale price ¥272,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanococcus maripaludis (strain C6 / ATCC BAA-1332)

Uniprot NO.:A9A8W5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLLLLLFSAIWYILPAYVANAVPCILGGGKPVDFGKTFFDGNRIIGNGVTYRGTFFGIL FGIITGILQHFIVILYMGPETVFDYGLFGYIILSFLLASGTLFGDMLGSFIKRRFKLNQG QSAPILDQITFIVFALLFAYPFYPLATNSIVLLLVISPIIHFSSNIIAYKLHLKKVWW

Protein Names:Recommended name: UPF0290 protein MmarC6_0973

Gene Names:Ordered Locus Names:MmarC6_0973

Expression Region:1-178

Sequence Info:full length protein

View full details