Recombinant Methanococcus maripaludis  Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

CSB-CF412855MNR
Regular price
¥169,500 JPY
Sale price
¥169,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanococcus maripaludis (strain C7 / ATCC BAA-1331)

Uniprot NO.:A6VHF1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIVKVCPELHIVMDVDSGLIAEMRKDILVVDLHPVEDEINKLAQYAKALENSLDPRNSP MKAYNGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

Gene Names:Name:mtrB Ordered Locus Names:MmarC7_0810

Expression Region:1-108

Sequence Info:full length protein

Your list is ready to share