Gene Bio Systems
Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)
Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)
SKU:CSB-CF389244MNP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Uniprot NO.:A4FVW2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDIVKVCPEIQIAMDIDSGLIAEMRKDILVVDLHPVEDEINRLAQYAKALENSLDPRNSP MKAYAGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL
Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Gene Names:Name:mtrB Ordered Locus Names:MmarC5_0013
Expression Region:1-108
Sequence Info:full length protein
