Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

SKU:CSB-CF389244MNP

Regular price ¥224,100 JPY
Regular price Sale price ¥224,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Uniprot NO.:A4FVW2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDIVKVCPEIQIAMDIDSGLIAEMRKDILVVDLHPVEDEINRLAQYAKALENSLDPRNSP MKAYAGREGTYKLAGMFQGMFFGFWVTMAILVLVTILAVKMNLSLIGL

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

Gene Names:Name:mtrB Ordered Locus Names:MmarC5_0013

Expression Region:1-108

Sequence Info:full length protein

View full details