Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1137(MJ1137)

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1137(MJ1137)

SKU:CSB-CF707408MRU

Regular price ¥271,700 JPY
Regular price Sale price ¥271,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Uniprot NO.:Q58537

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MREIYRQTIHLVFGVLIAFSVLIFKKQLIIPLIVSIVIGICLYFLCKRYYIPIVSDLLNL CKREKEDGKGAIYFAIGMLISLILIDDIKAVFFGILVFAVGDSLATIIGIRGKLKIKYFG KTVEGFLAFFISASLILYPFYGTYGIFVALISAFIEFVSKKIRIDDNLYLPFIVAFIINH QINICSLMNFI

Protein Names:Recommended name: Uncharacterized protein MJ1137

Gene Names:Ordered Locus Names:MJ1137

Expression Region:1-191

Sequence Info:full length protein

View full details