Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meriones unguiculatus Monocarboxylate transporter 2(SLC16A7)

Recombinant Meriones unguiculatus Monocarboxylate transporter 2(SLC16A7)

SKU:CSB-CF021414MRA

Regular price ¥252,500 JPY
Regular price Sale price ¥252,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)

Uniprot NO.:O35440

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AFVDMFSRPCGGLIANTRLVRPRIQYFFSLAIVFTGVCHLLCPLAESYTALVVYAIFFGY GFGSVSSILFE

Protein Names:Recommended name: Monocarboxylate transporter 2 Short name= MCT 2 Alternative name(s): Solute carrier family 16 member 7

Gene Names:Name:SLC16A7 Synonyms:MCT2

Expression Region:1-71

Sequence Info:full length protein

View full details