Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meriones unguiculatus Beta-1 adrenergic receptor(ADRB1)

Recombinant Meriones unguiculatus Beta-1 adrenergic receptor(ADRB1)

SKU:CSB-CF001391MRA

Regular price ¥248,400 JPY
Regular price Sale price ¥248,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)

Uniprot NO.:O70430

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ISALVSFLPILMHWWRAENDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVY LRVFREAQKQVKK

Protein Names:Recommended name: Beta-1 adrenergic receptor Alternative name(s): Beta-1 adrenoreceptor Short name= Beta-1 adrenoceptor

Gene Names:Name:ADRB1

Expression Region:1-73

Sequence Info:full length protein

View full details