Gene Bio Systems
Recombinant Mercuric transport protein(merT)
Recombinant Mercuric transport protein(merT)
SKU:CSB-CF333523FOI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces lividans
Uniprot NO.:P30345
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTPPPTQPGDRRGGLLGTLAVVGVALLPIICCAGPVLLASGALAGLGGVLVSPWLLAPAA VLLAGALTWWLRRRRTGNGDACCLPAPRTDQHDRDLLRKQ
Protein Names:Recommended name: Mercuric transport protein Alternative name(s): Mercury ion transport protein
Gene Names:Name:merT
Expression Region:1-100
Sequence Info:full length protein
