Recombinant Marmota monax Tumor necrosis factor(TNF),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Marmota monax Tumor necrosis factor(TNF),partial

CSB-BP523593MQG
Regular price
¥87,000 JPY
Sale price
¥87,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Immunology

Uniprot ID: O35734

Gene Names: TNF

Organism: Marmota monax (Woodchuck)

AA Sequence: GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL

Expression Region: 57-233aa

Sequence Info: Extracellular Domain

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

MW: 22.2 kDa

Alternative Name(s): Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2

Relevance: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Reference: "Woodchuck lymphotoxin-alpha, -beta and tumor necrosis factor genes: structure, characterization and biological activity." Li D.H., Havell E.A., Brown C.L., Cullen J.M. Gene 242:295-305(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Marmota monax Tumor necrosis factor(TNF),partial
    Regular price
    ¥158,300 JPY
    Sale price
    ¥158,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Bovie Tumor necrosis factor(TNF),partial
    Regular price
    ¥158,300 JPY
    Sale price
    ¥158,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Bovie Tumor necrosis factor(TNF),partial
    Regular price
    ¥158,300 JPY
    Sale price
    ¥158,300 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Tumor necrosis factor(Tnf),partial
    Regular price
    ¥158,300 JPY
    Sale price
    ¥158,300 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share