Skip to product information
1 of 1

Gene Bio Systems

Recombinant Malus domestica Chlorophyll a-b binding protein AB10, chloroplastic

Recombinant Malus domestica Chlorophyll a-b binding protein AB10, chloroplastic

SKU:CSB-CF325379MPS

Regular price ¥282,200 JPY
Regular price Sale price ¥282,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Malus domestica (Apple) (Pyrus malus)

Uniprot NO.:P15773

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKHAAKSKVSSSTCDRRVKYLGPFSGEWPSYLTGEFPGDYGWDTAGLSAYPETFAKNRE LEVIHSRCAMSAALGCIFPELLSVMGQGFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQS ILAIWTTKVILMGAVEGYRIARGPLGEVTDPLYPGSFDSLGLAEDTEAFAELKVKELKNG RLAMFSMFGFFVQAIVSRKDRLENLADHLGWTVNNNALSNVTNFVPGN

Protein Names:Recommended name: Chlorophyll a-b binding protein AB10, chloroplastic Alternative name(s): LHCII type I CAB-AB10 Short name= LHCP

Gene Names:

Expression Region:41-268

Sequence Info:full length protein

View full details