Gene Bio Systems
Recombinant Maize streak virus genotype A Movement protein (V2)
Recombinant Maize streak virus genotype A Movement protein (V2)
SKU:CSB-CF313669MBJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Maize streak virus genotype A (isolate Kenya) (MSV)
Uniprot NO.:P0C648
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDPQNALYYQPRVPTAAPTSGGVPWSRVGEVAILSFVALICFYLLYLWVLRDLILVLKAR QGRSTEELIFGGQAVDRSNPIPNIPAPPSQGNPGPFVPGTG
Protein Names:Recommended name: Movement protein Short name= MP
Gene Names:ORF Names:V2
Expression Region:1-101
Sequence Info:full length protein
