Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca mulatta (Rhesus macaque) CD226 antigen(CD226)

Recombinant Macaca mulatta (Rhesus macaque) CD226 antigen(CD226)

SKU:CSB-CF004901MOW

Regular price ¥294,000 JPY
Regular price Sale price ¥294,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca mulatta (Rhesus macaque)

Uniprot NO.:O18906

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKIQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRFVTGGTVLLLLFVISITTIIVIFLNRRRRRERSDLYTESWDTQKAPKNYRSPISASQPTNQSMDDTREDIYVNYPTFSRRPKTRV

Protein Names:Recommended name: CD226 antigen Alternative name(s): Platelet and T-cell activation antigen 1 CD_antigen= CD226

Gene Names:Name:CD226 Synonyms:PTA1

Expression Region:19-336

Sequence Info:full length protein

View full details