Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca mulatta Chemokine CCL20-MIP-3ALPHA(CCL20)

Recombinant Macaca mulatta Chemokine CCL20-MIP-3ALPHA(CCL20)

SKU:CSB-EP004784MOWe0

Regular price ¥165,300 JPY
Regular price Sale price ¥165,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8HYP6

Gene Names: CCL20

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Expression Region: 27-96aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35.1 kDa

Alternative Name(s):

Relevance:

Reference: Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines.Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A.Cytokine 18:140-148(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details