Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca fascicularis Signal peptidase complex subunit 2(SPCS2)

Recombinant Macaca fascicularis Signal peptidase complex subunit 2(SPCS2)

SKU:CSB-CF703100MOV

Regular price ¥279,700 JPY
Regular price Sale price ¥279,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Uniprot NO.:Q4R512

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AAAATQGGRSGGLGGNSGAGGGSNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAVERKIK

Protein Names:Recommended name: Signal peptidase complex subunit 2 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 25 kDa subunit Short name= SPase 25 kDa subunit

Gene Names:Name:SPCS2 ORF Names:QflA-13117

Expression Region:2-226

Sequence Info:full length protein

View full details