Gene Bio Systems
Recombinant Macaca fascicularis Prostaglandin E synthase(PTGES)
Recombinant Macaca fascicularis Prostaglandin E synthase(PTGES)
SKU:CSB-CF018976MOV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Uniprot NO.:Q6PWL6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPAHSLAMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLLGRVVHTVAYLGK LRAPIRSVTYTLAQLPCASMALQILWEAARHL
Protein Names:Recommended name: Prostaglandin E synthase EC= 5.3.99.3 Alternative name(s): Microsomal glutathione S-transferase 1-like 1 Short name= MGST1-L1 Microsomal prostaglandin E synthase 1 Short name= MPGES-1
Gene Names:Name:PTGES Synonyms:MGST1L1
Expression Region:1-152
Sequence Info:full length protein
