Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lolium latent virus Movement protein TGB2(ORF3)

Recombinant Lolium latent virus Movement protein TGB2(ORF3)

SKU:CSB-CF540205LQJ

Regular price ¥261,600 JPY
Regular price Sale price ¥261,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lolium latent virus (isolate Lolium/USA/US1/-) (LoLV)

Uniprot NO.:B1PS78

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSTSEPTYQLAPPDSLKQVYLTLAAGFAVGLGIFLLRTNTLPHTGDNIHHLPHGGCYRD GTKSIRYNSPGVATSSNIFLPAVAVLCILALLHVPFFQPDRVRRRCCRFYWCADPHHPTV

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 14 kDa protein Triple gene block 2 protein Short name= TGBp2

Gene Names:Name:ORF3

Expression Region:1-120

Sequence Info:full length protein

View full details