Recombinant Lithobates catesbeiana CDGSH iron-sulfur domain-containing protein 2(cisd2)

SKU: CSB-CF005443LQA

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Uniprot NO.:C1C524

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVLEILARVIKVQLPAYLKRLPVPDSIAGFIRLTVSEWLRLLPFLGVLALLGYLAIRPFLPKKKQQKDSLINLKIQKENPKVVNEIDIEDLRIAKVAYCRCWRSKTFPVCDGSHNKHNELTGDNVGPLILKKKEV

Protein Names:Recommended name: CDGSH iron-sulfur domain-containing protein 2

Gene Names:Name:cisd2

Expression Region:1-135

Sequence Info:full length protein