Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leuconostoc mesenteroides subsp. mesenteroides Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Leuconostoc mesenteroides subsp. mesenteroides Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF312883LFG

Regular price ¥290,400 JPY
Regular price Sale price ¥290,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523)

Uniprot NO.:Q03ZL4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNIMIGRFVPGDSWIHRLDPRTKMIGTFIFIFVMLWSTSWATYAWSAAFVVLAIRLTKQ PFRLYWDGLKPIFWLILFTVVLQLFFTPGTPVLLHAGPLKVTIPGIINAIYVMIRFVLII LMSTILTLTTPPTSIANALESLLKPLKKIHVPVAELSLMLSIALRFVPLLMDETQKIMNA QKSRGMSFSTGGPIKRAKAIVPLLIPLFVGALQRALDLANAMEVRGFQDATQRTKYRVLS YGSNDRSAFIGLIGFTIIFIGINFFIK

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:LEUM_0227

Expression Region:1-267

Sequence Info:full length protein

View full details