Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leishmania donovani Transitional endoplasmic reticulum ATPase,putative(LDBPK_361420),partial

Recombinant Leishmania donovani Transitional endoplasmic reticulum ATPase,putative(LDBPK_361420),partial

SKU:CSB-EP2530LOE

Regular price ¥190,500 JPY
Regular price Sale price ¥190,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: E9BTK1

Gene Names: LDBPK_361420

Organism: Leishmania donovani (strain BPK282A1)

AA Sequence: NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD

Expression Region: 15-98aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 13.7 kDa

Alternative Name(s):

Relevance:

Reference: "Whole genome sequencing of Leishmania donovani clinical lines reveals dynamic variation related to drug resistance." Downing T., Imamura H., Sanders M., Decuypere S., Hertz-Fowler C., Clark T.G., Rijal S., Sundar S., Quail M.A., De Doncker S., Maes I., Vanaerschot M., Stark O., Schonian G., Dujardin J.C., Berriman M. Submitted (FEB-2011)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details