Gene Bio Systems
Recombinant Lake Victoria marburgvirus Matrix protein VP40(VP40)
Recombinant Lake Victoria marburgvirus Matrix protein VP40(VP40)
SKU:CSB-EP638155LAAT
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q1PD51
Gene Names: VP40
Organism: Lake Victoria marburgvirus (strain Angola/2005) (MARV)
AA Sequence: MASSSNYNTYMQYLNPPPYADHGANQLIPADQLSNQQGITPNYVGDLNLDDQFKGNVCHAFTLEAIIDISAYNERTVKGVPAWLPLGIMSNFEYPLAHTVAALLTGSYTITQFTHNGQKFVRVNRLGTGIPAHPLRMLREGNQAFIQNMVIPRNFSTNQFTYNLTNLVLSVQKLPDDAWRPSKDKLIGNTMHPAVSVHPNLPPIVLPTVKKQAYRQHKNPNNGPLLAISGILHQLRVEKVPEKTSLFRISLPADMFSVKEGMMKKRGENSPVVYFQAPENFPLNGFNNRQVVLAYANPTLSAV
Expression Region: 1-303aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 49.8 kDa
Alternative Name(s): Membrane-associated protein VP40
Relevance: Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. May play a role in genome replication .
Reference: Marburgvirus genomics and association with a large hemorrhagic fever outbreak in Angola.Towner J.S., Khristova M.L., Sealy T.K., Vincent M.J., Erickson B.R., Bawiec D.A., Hartman A.L., Comer J.A., Zaki S.R., Stroeher U., Gomes da Silva F., del Castillo F., Rollin P.E., Ksiazek T.G., Nichol S.T.J. Virol. 80:6497-6516(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
