Gene Bio Systems
Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yxdF(yxdF)
Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yxdF(yxdF)
SKU:CSB-CF874970LNG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Uniprot NO.:Q9CDG9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLVLILIFIIAWKLGYLKNTLKNWDLKRIFWLMGIVFFTLATNYLVTVLVLKTQIISSV TSDTGMSDILGQLPILCQKYILGIIVPLSEELLFRSYIFGSITNKKVAFLISSVLFALVH TGFSWYLLPYLILSFIITWVYSKRNNFIESAIVHSSVNLFGGSAIKLLDTFFKLLPY
Protein Names:Recommended name: UPF0177 protein yxdF
Gene Names:Name:yxdF Ordered Locus Names:LL2251 ORF Names:L122569
Expression Region:1-177
Sequence Info:full length protein
