Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ(ybdJ)

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein ybdJ(ybdJ)

SKU:CSB-CF875019LNG

Regular price ¥280,800 JPY
Regular price Sale price ¥280,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Uniprot NO.:Q9CJ66

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIERIKKFLRTKFKPLLLLLVTVILYNGWTPHLGIFPPTFYDFAFNYYGFVDILTFLVII VIAYKNDAFKKIFDIFRPKNLLFILFFIVGGNIFIALAHHLYFQMTPALEAFPEHSIDLA NYFARTPFWTHSLDLFVIGPISEELIYREYLYRLFDKKCLACFVSVTMFAWVHTGFTYSF FLYLPISLVVTLAYHRRKAIGESIALHSSINLINTYLPNLLSFWVF

Protein Names:Recommended name: UPF0177 protein ybdJ

Gene Names:Name:ybdJ Ordered Locus Names:LL0135 ORF Names:L136552

Expression Region:1-226

Sequence Info:full length protein

View full details