Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppC(oppC)

Recombinant Lactococcus lactis subsp. lactis Oligopeptide transport system permease protein oppC(oppC)

SKU:CSB-CF363586LNG

Regular price ¥293,900 JPY
Regular price Sale price ¥293,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Uniprot NO.:P0A4N9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEKKHKNSLSLVHSIKEELKKDKLAMISTIFLVAVFLIVYIYSMFLKQSNYVDVNIMDQ YLAPLTNGHLLGTDNGGRDIIMMLMISARNSFNIAFAVTLITLVVGNILGVITGYFGGRF DLIFMRFTDFVMILPSMMIIIVFVTIIPRFNSWSLIGIISIFSWIGTTRLIRARTMTEVN RDYVRASKTSGTSDFKIMFREIWPNLSTLVIAEATLVFAGNIGLETGLSFLGFGLPAGTP SLGTMINEATNPETMTDKPWTWVPATVVILIVVLAIIFIGNALRRVADQRQATR

Protein Names:Recommended name: Oligopeptide transport system permease protein oppC

Gene Names:Name:oppC Ordered Locus Names:LL1838 ORF Names:L90358

Expression Region:1-294

Sequence Info:full length protein

View full details