Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus lactis subsp. cremoris UPF0397 protein LLNZ_01795 (LLNZ_01795)

Recombinant Lactococcus lactis subsp. cremoris UPF0397 protein LLNZ_01795 (LLNZ_01795)

SKU:CSB-CF518895LNE

Regular price ¥272,700 JPY
Regular price Sale price ¥272,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactococcus lactis subsp. cremoris (strain NZ9000)

Uniprot NO.:D8KFN3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNNSVKIVVATGIGAALFVIIGWLINIPTPIPNTSIQLQYAVLALFSALFGPLAGFLIG FIGHALKDSFLYGAPWWTWVLGSGLMGLFLGFGVKRESLTQGIFGNKEIIRFNIVQFLAN VVVWGLIAPIGDILVYSEPANKVFTQGVVAGLVNALTIAVAGTLLLKLYAATRTKSGTLD KE

Protein Names:Recommended name: UPF0397 protein LLNZ_01795 Alternative name(s): ORF6

Gene Names:Ordered Locus Names:LLNZ_01795

Expression Region:1-182

Sequence Info:full length protein

View full details