Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus plantarum Putative AgrB-like protein(lp_3582)

Recombinant Lactobacillus plantarum Putative AgrB-like protein(lp_3582)

SKU:CSB-CF775216LMS

Regular price ¥276,500 JPY
Regular price Sale price ¥276,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

Uniprot NO.:Q88S59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKPEQKLLLYKLSDRLFAAIQKNLQLERRQALLVKLGIDTVLNVIPKLIITIILALLLH ELVPVLVFMGSFLVLRGFAYGRHLESDLLCTILTAVTFVGVPYLIQFTDGIPELFRFILC LLLTVPIGMFSPAVTRKNPIKSQSLKRALKHKAIITSLVFSFLQFLVSNNLGTIIVVSLL LVFTLIVPLKGGKSDEAENV

Protein Names:Recommended name: Putative AgrB-like protein EC= 3.4.-.-

Gene Names:Ordered Locus Names:lp_3582

Expression Region:1-200

Sequence Info:full length protein

View full details