
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Uniprot NO.:B2GEU1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKEFKEFIARGNVMDLAVGVIIGAAFTAIVKSLVSNLINPLIGIFLGKIDLSNLVFSIG SAHFRYGSFLNEVINFLIIAFVVFLMVKGINKVMPKKEEEAVKEGPSKEEEYLGQIVELL KKQDK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:LAF_1837
Expression Region:1-125
Sequence Info:full length protein
You may also like
-
Recombinant Lactobacillus salivarius Large-conductance mechanosensitive channel(mscL)
- Regular price
- ¥168,700 JPY
- Sale price
- ¥168,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lactobacillus gasseri Large-conductance mechanosensitive channel(mscL)
- Regular price
- ¥168,700 JPY
- Sale price
- ¥168,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lactobacillus brevis Large-conductance mechanosensitive channel(mscL)
- Regular price
- ¥168,900 JPY
- Sale price
- ¥168,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lactobacillus acidophilus Large-conductance mechanosensitive channel(mscL)
- Regular price
- ¥168,600 JPY
- Sale price
- ¥168,600 JPY
- Regular price
-
- Unit price
- per
Sold out