Gene Bio Systems
Recombinant Lactate dehydrogenase-elevating virus Protein X(VPX)
Recombinant Lactate dehydrogenase-elevating virus Protein X(VPX)
SKU:CSB-CF314101LAJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactate dehydrogenase-elevating virus (LDV)
Uniprot NO.:P0C781
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGGLEFCDQTSWYQIFIAFSLTYTPIAIYSLKVFRGTLAGIVNIFIFINCCVSFVYLMYH HSVTNTIALSLGAVIALVWGIYTLVKIVDWLVIRCRLCFLGRSYILAPPSHVDTSDGRQS LTTSLTTAFVVRKPGSTLVNGQLVPDFQRLVLGGKKAVSKGAVNLLKYVSK
Protein Names:Recommended name: Protein X Alternative name(s): Envelope protein VpX
Gene Names:Name:VPX
Expression Region:1-171
Sequence Info:full length protein
