
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Koribacter versatilis (strain Ellin345)
Uniprot NO.:Q1IIG4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYAQEAQQKPEAQQSAPAAEQPKPAEEQAKPEQHVTNPNAAVGKELSEASHAAEGEEEAG EHMELKHSTMVKTLAKWLGVSVETSYWIAMAFNFAIVFALLGWAMKKNLPGVFKARNESI QRGIAEARAASDDAKRRLADIEARLSKMDGEVAAIRAVTEKESAAEEVRIREAAEADVKR ILESAENEIDAATKQARRDLKSLAAGLAIDLATRKLHVDQQTDESLVRSFVAQLGKDGK
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:Acid345_4336
Expression Region:1-239
Sequence Info:full length protein
You may also like
-
Recombinant Koribacter versatilis ATP synthase subunit a(atpB)
- Regular price
- ¥182,200 JPY
- Sale price
- ¥182,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Corynebacterium urealyticum ATP synthase subunit b(atpF)
- Regular price
- ¥175,000 JPY
- Sale price
- ¥175,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Corynebacterium jeikeium ATP synthase subunit b(atpF)
- Regular price
- ¥175,000 JPY
- Sale price
- ¥175,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant ATP synthase subunit b(atpF)
- Regular price
- ¥175,600 JPY
- Sale price
- ¥175,600 JPY
- Regular price
-
- Unit price
- per
Sold out