
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
Uniprot NO.:P20387
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DVPTPYGMYFQDSATPNQEGILELHDNIMFYLFIILGLVSWLLFTIVRTYSKNPIAYKYI KHGQTIEIIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGLQWYWKYEYSDFIN DNGETVEFESYVIPEDLLEDGQLRLLDTDTSVVVPVDTHIRFVVTAADVIHDFAVPSLGI KIDAAPGRLNQVSALIQREGVFYGQCSEICGQSHSAMPIKIEAVSLPAFLEWLNEQ
Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Gene Names:Name:COX2
Expression Region:12-247
Sequence Info:full length protein
You may also like
-
Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 3(COX3)
- Regular price
- ¥185,200 JPY
- Sale price
- ¥185,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lachancea thermotolerans Cytochrome c oxidase subunit 2(COX2)
- Regular price
- ¥181,200 JPY
- Sale price
- ¥181,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lachancea kluyveri Cytochrome c oxidase subunit 2(COX2)
- Regular price
- ¥181,200 JPY
- Sale price
- ¥181,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Kluyveromyces lactis Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
- Regular price
- ¥163,300 JPY
- Sale price
- ¥163,300 JPY
- Regular price
-
- Unit price
- per
Sold out