Gene Bio Systems
Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfoxide reductase heme-binding subunit YedZ(yedZ)
Recombinant Klebsiella pneumoniae subsp. pneumoniae Sulfoxide reductase heme-binding subunit YedZ(yedZ)
SKU:CSB-CF407625KAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Uniprot NO.:A6TES0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRFTVKQIVWLKVLLHLAGFLPLVWLFWAGHQGYFSADPAKDIQHFTGRMALKFLLATLL VSPLARYAKQPLLIRVRRLLGLWCFAWATLHLTSYTLLELGINNLALLGSEIITRPYLTL GMISWAILLALAVTSTQAMQRKLGRRWQLLHNFVYLVAILAPIHYLWSVKIVSPQPVVYA LLAAGLLTWRYKKFRQWWRAIR
Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ
Gene Names:Name:yedZ Ordered Locus Names:KPN78578_36300 ORF Names:KPN_03662
Expression Region:1-202
Sequence Info:full length protein
