Skip to product information
1 of 1

Gene Bio Systems

Recombinant Klebsiella pneumoniae Fumarate reductase subunit D(frdD)

Recombinant Klebsiella pneumoniae Fumarate reductase subunit D(frdD)

SKU:CSB-CF469027KBH

Regular price ¥254,900 JPY
Regular price Sale price ¥254,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Klebsiella pneumoniae (strain 342)

Uniprot NO.:B5Y349

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MINPNPKRSDEPVFWGLFGAGGMWGAIVAPVMVLLVGILLPLGLAPADAFSYERVLAFAQ SFIGRAFIFLMIVLPLWCGLHRIHHAMHDLKIHVPNGKWVFYGLAAILSVITLVGVLFI

Protein Names:Recommended name: Fumarate reductase subunit D Alternative name(s): Fumarate reductase 13 kDa hydrophobic protein

Gene Names:Name:frdD Ordered Locus Names:KPK_5118

Expression Region:1-119

Sequence Info:full length protein

View full details