Skip to product information
1 of 1

Gene Bio Systems

Recombinant Klebsiella pneumoniae Fimbrial subunit type 3(mrkA)

Recombinant Klebsiella pneumoniae Fimbrial subunit type 3(mrkA)

SKU:CSB-EP318939KBG

Regular price ¥165,500 JPY
Regular price Sale price ¥165,500 JPY
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Microbiology

Target / Protein: mrkA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Klebsiella pneumoniae

Delivery time: 3-7 business days

Uniprot ID: P12267

AA Sequence: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-202aa

Protein length: Full length of Mature Protein

MW: 34.5 kDa

Alternative Name(s):

Relevance:

Reference: "Molecular characterization of the type 3 (MR/K) fimbriae of Klebsiella pneumoniae."Gerlach G.-F., Allen B.L., Clegg S.J. Bacteriol. 170:3547-3553(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details