Skip to product information
1 of 1

Gene Bio Systems

Recombinant Jannaschia sp. ATP synthase subunit b'(atpG)

Recombinant Jannaschia sp. ATP synthase subunit b'(atpG)

SKU:CSB-CF642724JAAA

Regular price ¥267,700 JPY
Regular price Sale price ¥267,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Jannaschia sp. (strain CCS1)

Uniprot NO.:Q28UC6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADEAETLDAAHGATDAAHGAADAAHASSPGMPQLDFATFPNQIFWLVLTLLAIYFVLTK IALPRISSVIAERQGTLTNDLAAAEDLKRQAAEAEESYNTALANARAEASRIAQETRDEI QAQTQVEIDKADAQIAARTAEGEARIAEIEAGAIATAEEVARDVATEIVRAFGPGQDVDA AAVADAVANRVRG

Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b'

Gene Names:Name:atpG Ordered Locus Names:Jann_0769

Expression Region:1-193

Sequence Info:full length protein

View full details