Gene Bio Systems
Recombinant Isochrysis galbana Fucoxanthin-chlorophyll a-c binding protein, chloroplastic(FCP)
Recombinant Isochrysis galbana Fucoxanthin-chlorophyll a-c binding protein, chloroplastic(FCP)
SKU:CSB-CF661202IAAV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Isochrysis galbana (Marine planktonic alga)
Uniprot NO.:Q39709
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:FAYGLPGGANILGEFDPAGFLKGKDKLEVYRLREAETTHGRVAMLASLGFVVQEKFHPLF SGDNGPAIEQIPQLPYWLWIVMTIGIGRAELFRIQKGWAKVNPETGKADSALREGYEPGD LGFDPLGLAPSDPDEFRLMQEKELSHGRLAMIAAAGFLAQEAVSGDTWGTYWGDATF
Protein Names:Recommended name: Fucoxanthin-chlorophyll a-c binding protein, chloroplastic Short name= FCP
Gene Names:Name:FCP
Expression Region:32-208
Sequence Info:full length protein
