Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ipomoea nil CASP-like protein IN26(IN26)

Recombinant Ipomoea nil CASP-like protein IN26(IN26)

SKU:CSB-CF381509INC

Regular price ¥276,000 JPY
Regular price Sale price ¥276,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ipomoea nil (Japanese morning glory) (Pharbitis nil)

Uniprot NO.:A2PZE5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VAPTGSVETEKAGPSYKPKEYYKVTEAILRLLLLASLVVAVVVMVTSKETELISVKLDPF PPFMLPLTAKFTQSPAFIYFVAGLSVAGLYTIISTLASFYNLLIKPGFCPALVSHFIILD VVMLGIVGTATGAAGGVAYIGLKGNSHVGWTKVCNKYGKLCTHLGASLAVSFFAFIVLLL LIILSIHSLSKKIPK

Protein Names:Recommended name: CASP-like protein IN26

Gene Names:Name:IN26

Expression Region:1-195

Sequence Info:full length protein

View full details