Skip to product information
1 of 1

Gene Bio Systems

Recombinant Invertebrate iridescent virus 6 Transmembrane protein 300R(IIV6-300R)

Recombinant Invertebrate iridescent virus 6 Transmembrane protein 300R(IIV6-300R)

SKU:CSB-CF835542INA

Regular price ¥251,100 JPY
Regular price Sale price ¥251,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Uniprot NO.:Q91FM4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKEFLDLYMILSVLAGVIGIFYLTTPYQDRPDKSLSYYMTLSVVTGILALIYLQNHHKK N

Protein Names:Recommended name: Transmembrane protein 300R

Gene Names:ORF Names:IIV6-300R

Expression Region:1-61

Sequence Info:full length protein

View full details