Skip to product information
1 of 1

Gene Bio Systems

Recombinant Invertebrate iridescent virus 3 Uncharacterized protein IIV3-013L(IIV3-013L)

Recombinant Invertebrate iridescent virus 3 Uncharacterized protein IIV3-013L(IIV3-013L)

SKU:CSB-CF619315IAAL

Regular price ¥253,600 JPY
Regular price Sale price ¥253,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)

Uniprot NO.:Q197E7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYYRDQYGNVKYAPEGMGPHHAASSSHHSAQHHHMTKENFSMDDVHSWFEKYKMWFLYAL ILALIFGVFMWWSKYNHDKKRSLNTASIFY

Protein Names:Recommended name: Uncharacterized protein IIV3-013L

Gene Names:ORF Names:IIV3-013L

Expression Region:1-90

Sequence Info:full length protein

View full details