
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shigella flexneri
Uniprot NO.:P0ADM3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG
Protein Names:Recommended name: Inner membrane protein yidH
Gene Names:Name:yidH Ordered Locus Names:SF3786, S3983
Expression Region:1-115
Sequence Info:full length protein
You may also like
-
Recombinant Inner membrane protein yidH(yidH)
- Regular price
- ¥217,900 JPY
- Sale price
- ¥217,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Inner membrane protein yidG(yidG)
- Regular price
- ¥218,800 JPY
- Sale price
- ¥218,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Inner membrane protein yidH(yidH)
- Regular price
- ¥217,900 JPY
- Sale price
- ¥217,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Inner membrane protein yjcH(yjcH)
- Regular price
- ¥216,200 JPY
- Sale price
- ¥216,200 JPY
- Regular price
-
- Unit price
- per
Sold out