Skip to product information
1 of 1

Gene Bio Systems

Recombinant Inner membrane protein ydgC(ydgC)

Recombinant Inner membrane protein ydgC(ydgC)

SKU:CSB-CF364876SZB

Regular price ¥225,400 JPY
Regular price Sale price ¥225,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0ACX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLVIKAALGALVVLLIGVLAKTKNYYIAGLIPLFPTFALIAHYIVASERGIEALRATII FSMWSIIPYFVYLVSLWYFTGMMRLPAAFVGSVACWGISAWVLIICWIKLH

Protein Names:Recommended name: Inner membrane protein ydgC

Gene Names:Name:ydgC Ordered Locus Names:SF1628, S1760

Expression Region:1-111

Sequence Info:full length protein

View full details